Lineage for d4i4ba2 (4i4b A:111-220)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417422Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 1417423Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 1417424Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 1417462Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
    Uniprot P13702 4-377
  8. 1417469Domain d4i4ba2: 4i4b A:111-220 [222896]
    Other proteins in same PDB: d4i4ba1, d4i4bb1
    automated match to d1qaxa1
    complexed with 1co, 1cv, gol, nad, so4

Details for d4i4ba2

PDB Entry: 4i4b (more details), 1.7 Å

PDB Description: hmg-coa reductase from pseudomonas mevalonii complexed with nad and intermediate hemiacetal form of hmg-coa
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i4ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i4ba2 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOPe Domain Coordinates for d4i4ba2:

Click to download the PDB-style file with coordinates for d4i4ba2.
(The format of our PDB-style files is described here.)

Timeline for d4i4ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i4ba1