Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries) |
Domain d4i42j_: 4i42 J: [222891] automated match to d4elwa_ complexed with 1ha, bct, btb, cl, edo, gol, peg, so4 |
PDB Entry: 4i42 (more details), 1.85 Å
SCOPe Domain Sequences for d4i42j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i42j_ c.14.1.0 (J:) automated matches {Escherichia coli K-12 [TaxId: 83333]} miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
Timeline for d4i42j_: