Lineage for d4i42g_ (4i42 G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585253Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries)
  8. 1585260Domain d4i42g_: 4i42 G: [222888]
    automated match to d4elwa_
    complexed with 1ha, bct, btb, cl, edo, gol, peg, so4

Details for d4i42g_

PDB Entry: 4i42 (more details), 1.85 Å

PDB Description: E.coli. 1,4-dihydroxy-2-naphthoyl coenzyme A synthase (ecMenB) in complex with 1-hydroxy-2-naphthoyl-CoA
PDB Compounds: (G:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d4i42g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i42g_ c.14.1.0 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp

SCOPe Domain Coordinates for d4i42g_:

Click to download the PDB-style file with coordinates for d4i42g_.
(The format of our PDB-style files is described here.)

Timeline for d4i42g_: