![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.1: PYP-like [55786] (3 proteins) |
![]() | Protein Photoactive yellow protein, PYP [55787] (1 species) |
![]() | Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (84 PDB entries) Uniprot P16113 |
![]() | Domain d4i38a_: 4i38 A: [222875] automated match to d1nwza_ complexed with hc4 |
PDB Entry: 4i38 (more details), 1.6 Å
SCOPe Domain Sequences for d4i38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i38a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]} mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv fvkrv
Timeline for d4i38a_: