Lineage for d4i36d_ (4i36 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911725Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2911726Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2911727Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)
  6. 2911728Protein ATP-dependent phosphofructokinase [53786] (2 species)
    Domain 1 binds ATP
  7. 2911729Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries)
  8. 2911743Domain d4i36d_: 4i36 D: [222874]
    automated match to d3u39b_
    mutant

Details for d4i36d_

PDB Entry: 4i36 (more details), 2.3 Å

PDB Description: crystal structure of the bacillus stearothermophilus phosphofructokinase mutant d12a
PDB Compounds: (D:) 6-phosphofructokinase

SCOPe Domain Sequences for d4i36d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i36d_ c.89.1.1 (D:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]}
mkrigvltsggaspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOPe Domain Coordinates for d4i36d_:

Click to download the PDB-style file with coordinates for d4i36d_.
(The format of our PDB-style files is described here.)

Timeline for d4i36d_: