SCOPe 2.06: Domain d1sdyc_: 1sdy C:

Lineage for d1sdyc_ (1sdy C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1sdyc_: 1sdy C: [22287]
   complexed with cu, zn

Details for d1sdyc_

PDB Entry: 1sdy, 2.5 Å

PDB Description: structure solution and molecular dynamics refinement of the yeast cu, zn enzyme superoxide dismutase

PDB Compounds: (C:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d1sdyc_:

Sequence; same for both SEQRES and ATOM records:

>d1sdyc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1sdyc_:

• d1sdyc_ first appeared (with stable ids) in SCOP 1.55
  
• d1sdyc_ appears in SCOPe 2.05
  
• d1sdyc_ appears in SCOPe 2.07
  
• d1sdyc_ appears in the current release, SCOPe 2.08