Lineage for d1sdyc_ (1sdy C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788402Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 788403Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 788416Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 788423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)
  8. 788441Domain d1sdyc_: 1sdy C: [22287]

Details for d1sdyc_

PDB Entry: 1sdy (more details), 2.5 Å

PDB Description: structure solution and molecular dynamics refinement of the yeast cu, zn enzyme superoxide dismutase
PDB Compounds: (C:) Copper,Zinc Superoxide Dismutase

SCOP Domain Sequences for d1sdyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdyc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOP Domain Coordinates for d1sdyc_:

Click to download the PDB-style file with coordinates for d1sdyc_.
(The format of our PDB-style files is described here.)

Timeline for d1sdyc_: