SCOPe 2.08: Domain d4i2pa2: 4i2p A:430-552

Lineage for d4i2pa2 (4i2p A:430-552)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries)

8. Domain d4i2pa2: 4i2p A:430-552 [222866]
   Other proteins in same PDB: d4i2pa1, d4i2pa3, d4i2pb_
   automated match to d1bqna1
   protein/DNA complex; protein/RNA complex; complexed with g73

Details for d4i2pa2

PDB Entry: 4i2p, 2.3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4i2pa2:

Sequence; same for both SEQRES and ATOM records:

>d4i2pa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d4i2pa2:

• d4i2pa2 first appeared in SCOPe 2.03
  
• d4i2pa2 appears in SCOPe 2.07