Lineage for d4i1yc1 (4i1y C:1-297)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140158Species Mycobacterium ulcerans [TaxId:362242] [226546] (1 PDB entry)
  8. 2140161Domain d4i1yc1: 4i1y C:1-297 [222863]
    Other proteins in same PDB: d4i1yb2, d4i1yc2, d4i1yd2
    automated match to d1oasa_
    complexed with cl, so4

Details for d4i1yc1

PDB Entry: 4i1y (more details), 2.6 Å

PDB Description: the structure of cysteine synthase from mycobacterium ulcerans agy99
PDB Compounds: (C:) Cysteine synthase

SCOPe Domain Sequences for d4i1yc1:

Sequence, based on SEQRES records: (download)

>d4i1yc1 c.79.1.0 (C:1-297) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
mtiaeniaqliggtplvrlrrvtdgaaadvvaklesfnpagsikdrigvamidaaekagl
ikpdtiileptsgntgialamvsaargykcvltmpdtmsierrmllraygaelvltpgae
gmagaiakaeelaktddryfipqqfenpanpavhavttaeevwrdtdgkvdifvsgvgtg
gtitgvaqvikqrrpsaqfvavepaaspvlsggqkgphpiqgigagfvppvldlalvdev
itvgnddalelarrmateegllfgissgaavwaarelahrpenagklivvvlpdfge

Sequence, based on observed residues (ATOM records): (download)

>d4i1yc1 c.79.1.0 (C:1-297) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
mtiaeniaqliggtplvrlrrvtdgaaadvvaklesfnpagsikdrigvamidaaekagl
ikpdtiileptsgntgialamvsaargykcvltmpdtmsierrmllraygaelvltpgae
gmagaiakaeelaktddryfipnpavhavttaeevwrdtdgkvdifvsgvgtggtitgva
qvikqrrpsaqfvaveppvldlalvdevitvgnddalelarrmateegllfgissgaavw
aarelahrpenagklivvvlpdfge

SCOPe Domain Coordinates for d4i1yc1:

Click to download the PDB-style file with coordinates for d4i1yc1.
(The format of our PDB-style files is described here.)

Timeline for d4i1yc1: