Lineage for d4i1qb_ (4i1q B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737998Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2737999Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2738058Family a.238.1.0: automated matches [191660] (1 protein)
    not a true family
  6. 2738059Protein automated matches [191240] (2 species)
    not a true protein
  7. 2738060Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)
  8. 2738066Domain d4i1qb_: 4i1q B: [222858]
    automated match to d1urua_

Details for d4i1qb_

PDB Entry: 4i1q (more details), 2.53 Å

PDB Description: Crystal Structure of hBRAP1 N-BAR domain
PDB Compounds: (B:) bridging integrator 2

SCOPe Domain Sequences for d4i1qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i1qb_ a.238.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erfeqsannfyqqqaeghklykdlknflsavkvmhesskrvsetlqeiyssewdgheelk
aivwnndllwedyeekladqavrtmeiyvaqfseikeriakrgrklvdydsarhhleavq
nakkkdeaktakaeeefnkaqtvfedlnqelleelpilynsrigcyvtifqnisnlrdvf
yremsklnhnlyevmskl

SCOPe Domain Coordinates for d4i1qb_:

Click to download the PDB-style file with coordinates for d4i1qb_.
(The format of our PDB-style files is described here.)

Timeline for d4i1qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4i1qa_