SCOPe 2.08: Domain d4i1qa_: 4i1q A:

Lineage for d4i1qa_ (4i1q A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)

8. Domain d4i1qa_: 4i1q A: [222857]
   automated match to d1urua_

Details for d4i1qa_

PDB Entry: 4i1q, 2.53 Å

PDB Description: Crystal Structure of hBRAP1 N-BAR domain

PDB Compounds: (A:) bridging integrator 2

SCOPe Domain Sequences for d4i1qa_:

Sequence; same for both SEQRES and ATOM records:

>d4i1qa_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kderfeqsannfyqqqaeghklykdlknflsavkvmhesskrvsetlqeiyssewdghee
lkaivwnndllwedyeekladqavrtmeiyvaqfseikeriakrgrklvdydsarhhlea
vqnakkkdeaktakaeeefnkaqtvfedlnqelleelpilynsrigcyvtifqnisnlrd
vfyremsklnhnlyevmskl

Timeline for d4i1qa_:

• d4i1qa_ first appeared in SCOPe 2.03
  
• d4i1qa_ appears in SCOPe 2.07