SCOPe 2.05: Domain d4i1ia1: 4i1i A:-1-155

Lineage for d4i1ia1 (4i1i A:-1-155)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Leishmania major [TaxId:347515] [226495] (2 PDB entries)

8. Domain d4i1ia1: 4i1i A:-1-155 [222853]
   Other proteins in same PDB: d4i1ia2, d4i1ib2
   automated match to d1civa1
   complexed with edo, nad, po4

Details for d4i1ia1

PDB Entry: 4i1i, 1.5 Å

PDB Description: crystal structure of a putative cytosolic malate dehydrogenase from leishmania major friedlin in complex with nad

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4i1ia1:

Sequence; same for both SEQRES and ATOM records:

>d4i1ia1 c.2.1.0 (A:-1-155) automated matches {Leishmania major [TaxId: 347515]}
gsmsavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeled
cafplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaav
aasdcrvvvvgnpantnalillksaqgklnprhvtam

Timeline for d4i1ia1:

• d4i1ia1 first appeared in SCOPe 2.03
  
• d4i1ia1 appears in SCOPe 2.04
  
• d4i1ia1 appears in SCOPe 2.06
  
• d4i1ia1 appears in the current release, SCOPe 2.08