Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Leishmania major [TaxId:347515] [226495] (2 PDB entries) |
Domain d4i1ia1: 4i1i A:-1-155 [222853] Other proteins in same PDB: d4i1ia2, d4i1ib2 automated match to d1civa1 complexed with edo, nad, po4 |
PDB Entry: 4i1i (more details), 1.5 Å
SCOPe Domain Sequences for d4i1ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1ia1 c.2.1.0 (A:-1-155) automated matches {Leishmania major [TaxId: 347515]} gsmsavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeled cafplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaav aasdcrvvvvgnpantnalillksaqgklnprhvtam
Timeline for d4i1ia1: