Lineage for d4i10a_ (4i10 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1322142Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1322199Protein beta-secretase (memapsin) [50671] (1 species)
  7. 1322200Species Human (Homo sapiens) [TaxId:9606] [50672] (229 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 1322368Domain d4i10a_: 4i10 A: [222849]
    automated match to d4i0za_
    complexed with 1bs, zn

Details for d4i10a_

PDB Entry: 4i10 (more details), 2.07 Å

PDB Description: Structure-based design of novel dihydroisoquinoline BACE-1 inhibitors that do not engage the catalytic aspartates
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4i10a_:

Sequence, based on SEQRES records: (download)

>d4i10a_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgynipqtdesrshhhh

Sequence, based on observed residues (ATOM records): (download)

>d4i10a_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcglasvggsmiiggidhslytgsl
wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
kaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrp
vedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrta
avegpfvtldmedcgynipqtdesrshhhh

SCOPe Domain Coordinates for d4i10a_:

Click to download the PDB-style file with coordinates for d4i10a_.
(The format of our PDB-style files is described here.)

Timeline for d4i10a_: