Lineage for d1yaza_ (1yaz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)
  8. 2763748Domain d1yaza_: 1yaz A: [22284]
    complexed with azi, cu, zn

Details for d1yaza_

PDB Entry: 1yaz (more details), 1.7 Å

PDB Description: azide-bound yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure
PDB Compounds: (A:) protein (cu/zn superoxide dismutase)

SCOPe Domain Sequences for d1yaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaza_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOPe Domain Coordinates for d1yaza_:

Click to download the PDB-style file with coordinates for d1yaza_.
(The format of our PDB-style files is described here.)

Timeline for d1yaza_: