SCOPe 2.08: Domain d4i0ud1: 4i0u D:7-285

Lineage for d4i0ud1 (4i0u D:7-285)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
   beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel

4. Superfamily d.328.1: CorA soluble domain-like [143865] (1 family)

5. Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
   N-terminal part of Pfam PF01544

6. Protein automated matches [227110] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries)

8. Domain d4i0ud1: 4i0u D:7-285 [222835]
   Other proteins in same PDB: d4i0ua2, d4i0ub2, d4i0uc2, d4i0ud2, d4i0ue2, d4i0uf2, d4i0ug2, d4i0uh2, d4i0ui2, d4i0uj2
   automated match to d2iuba1
   complexed with cl, lmt, mg, peg, pg0

Details for d4i0ud1

PDB Entry: 4i0u, 2.7 Å

PDB Description: Improved structure of Thermotoga maritima CorA at 2.7 A resolution

PDB Compounds: (D:) Magnesium transport protein corA

SCOPe Domain Sequences for d4i0ud1:

Sequence; same for both SEQRES and ATOM records:

>d4i0ud1 d.328.1.1 (D:7-285) automated matches {Thermotoga maritima [TaxId: 243274]}
sakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitg
ihrtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseq
vsliltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlle
kiddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieke
tvpyfrdvydhtiqiadtvetfrdivsglldvylssvsn

Timeline for d4i0ud1:

• d4i0ud1 first appeared in SCOPe 2.03
  
• d4i0ud1 appears in SCOPe 2.07