Lineage for d1b4ta_ (1b4t A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (7 PDB entries) 
Domain d1b4ta_: 1b4t A: [22283]
Details for d1b4ta_
PDB Entry: 1b4t (more details), 1.8 Å
PDB Description: h48c yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure
SCOP Domain Sequences for d1b4ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ta_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhicefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn
SCOP Domain Coordinates for d1b4ta_:
Click to download the PDB-style file with coordinates for d1b4ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b4ta_:
- d1b4ta_ appears in SCOP 1.57
- d1b4ta_ appears in the current release, SCOPe 2.08
View in 3D