Lineage for d4i06a_ (4i06 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115344Protein Arginase [52770] (5 species)
  7. 2115426Species Human (Homo sapiens), isoform II, mitochondrial [TaxId:9606] [102412] (7 PDB entries)
  8. 2115430Domain d4i06a_: 4i06 A: [222818]
    automated match to d1pq3a_
    complexed with ben, bme, mn, x8a

Details for d4i06a_

PDB Entry: 4i06 (more details), 1.8 Å

PDB Description: Crystal structure of human Arginase-2 complexed with inhibitor 14
PDB Compounds: (A:) Arginase-2, mitochondrial

SCOPe Domain Sequences for d4i06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i06a_ c.42.1.1 (A:) Arginase {Human (Homo sapiens), isoform II, mitochondrial [TaxId: 9606]}
hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
gqtreg

SCOPe Domain Coordinates for d4i06a_:

Click to download the PDB-style file with coordinates for d4i06a_.
(The format of our PDB-style files is described here.)

Timeline for d4i06a_: