SCOPe 2.06: Domain d4hzll2: 4hzl L:114-217

Lineage for d4hzll2 (4hzl L:114-217)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d4hzll2: 4hzl L:114-217 [222816]
   Other proteins in same PDB: d4hzlb1, d4hzll1
   automated match to d2jell2

Details for d4hzll2

PDB Entry: 4hzl, 2.85 Å

PDB Description: Neutralizing antibody mAb#8 in complex with the Epitope II of HCV E2 envelope protein

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4hzll2:

Sequence; same for both SEQRES and ATOM records:

>d4hzll2 b.1.1.0 (L:114-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4hzll2:

• d4hzll2 first appeared in SCOPe 2.03
  
• d4hzll2 appears in SCOPe 2.05
  
• d4hzll2 appears in the current release, SCOPe 2.07