Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4hzlb2: 4hzl B:114-217 [222814] Other proteins in same PDB: d4hzla_, d4hzlb1, d4hzlh_, d4hzll1 automated match to d2jell2 |
PDB Entry: 4hzl (more details), 2.85 Å
SCOPe Domain Sequences for d4hzlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hzlb2 b.1.1.0 (B:114-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4hzlb2:
View in 3D Domains from other chains: (mouse over for more information) d4hzla_, d4hzlh_, d4hzll1, d4hzll2 |