Lineage for d4hz5j_ (4hz5 J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580561Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)
  8. 2580578Domain d4hz5j_: 4hz5 J: [222812]
    automated match to d1kzna_
    complexed with 19y

Details for d4hz5j_

PDB Entry: 4hz5 (more details), 2.7 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity
PDB Compounds: (J:) DNA topoisomerase IV, B subunit

SCOPe Domain Sequences for d4hz5j_:

Sequence, based on SEQRES records: (download)

>d4hz5j_ d.122.1.0 (J:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstdsrglhhlvyeivdnavdealsgygneinvtiqkdnsicvadsg
rgmptgmhasgiptveviftvlhaggkfgqggyktsgglhgvgasvvnalskwlevhivr
dgveymerfedggkpvgtlkkigktkkrngtsvtflpddtifsttnfsyeilaerlresa
fllkgvkitltdergeepkeevfhyee

Sequence, based on observed residues (ATOM records): (download)

>d4hz5j_ d.122.1.0 (J:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstdsrglhhlvyeivdnavdealsgygneinvtiqkdnsicvadsg
rgmptgmhasgiptveviftvlhgvgasvvnalskwlevhivrdgeymerfedggkpvgt
lkkigtkngtsvtflpddtifttnfsyeilaerlresafllkgvkitltdergeepkeev
fhyee

SCOPe Domain Coordinates for d4hz5j_:

Click to download the PDB-style file with coordinates for d4hz5j_.
(The format of our PDB-style files is described here.)

Timeline for d4hz5j_: