Lineage for d4hz5h_ (4hz5 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974002Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)
  8. 2974018Domain d4hz5h_: 4hz5 H: [222811]
    automated match to d1kzna_
    complexed with 19y

Details for d4hz5h_

PDB Entry: 4hz5 (more details), 2.7 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity
PDB Compounds: (H:) DNA topoisomerase IV, B subunit

SCOPe Domain Sequences for d4hz5h_:

Sequence, based on SEQRES records: (download)

>d4hz5h_ d.122.1.0 (H:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstdsrglhhlvyeivdnavdealsgygneinvtiqkdnsicvadsg
rgmptgmhasgiptveviftvlhaggkfgqggyktsgglhgvgasvvnalskwlevhivr
dgveymerfedggkpvgtlkkigktkkrngtsvtflpddtifsttnfsyeilaerlresa
fllkgvkitltdergeepkeevfhyee

Sequence, based on observed residues (ATOM records): (download)

>d4hz5h_ d.122.1.0 (H:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstdsrglhhlvyeivdnavdealsgygneinvtiqkdnsicvadsg
rgmptgmhasgiptveviftvlhhgvgasvvnalskwlevhivrdgveymerfedggkpv
gtlkkigktkkrngtsvtflpddtifsttnfsyeilaerlresafllkgvkitltderge
epkeevfhyee

SCOPe Domain Coordinates for d4hz5h_:

Click to download the PDB-style file with coordinates for d4hz5h_.
(The format of our PDB-style files is described here.)

Timeline for d4hz5h_: