SCOPe 2.05: Domain d1ysoa_: 1yso A:

Lineage for d1ysoa_ (1yso A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1ysoa_: 1yso A: [22281]
   complexed with cu1, zn

Details for d1ysoa_

PDB Entry: 1yso, 1.73 Å

PDB Description: yeast cu, zn superoxide dismutase with the reduced bridge broken

PDB Compounds: (A:) yeast cu, zn superoxide dismutase

SCOPe Domain Sequences for d1ysoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ysoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1ysoa_:

• d1ysoa_ first appeared (with stable ids) in SCOP 1.55, called d1yso__
  
• d1ysoa_ appears in SCOPe 2.04
  
• d1ysoa_ appears in SCOPe 2.06
  
• d1ysoa_ appears in the current release, SCOPe 2.08