Lineage for d1yso__ (1yso -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (7 PDB entries) 
Domain d1yso__: 1yso - [22281]
Details for d1yso__
PDB Entry: 1yso (more details), 1.73 Å
PDB Description: yeast cu, zn superoxide dismutase with the reduced bridge broken
SCOP Domain Sequences for d1yso__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yso__ b.1.8.1 (-) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn
SCOP Domain Coordinates for d1yso__:
Click to download the PDB-style file with coordinates for d1yso__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yso__:
- d1yso__ appears in SCOP 1.57
- d1yso__ appears in the current release, SCOPe 2.08, called d1ysoa_
View in 3D