SCOPe 2.03: Domain d4hz0a_: 4hz0 A:

Lineage for d4hz0a_ (4hz0 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225819] (2 PDB entries)

8. Domain d4hz0a_: 4hz0 A: [222802]
   automated match to d1kzna_
   complexed with 1av, mg

Details for d4hz0a_

PDB Entry: 4hz0, 2.2 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.

PDB Compounds: (A:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d4hz0a_:

Sequence, based on SEQRES records:

>d4hz0a_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrg
mpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnalskrvevnvrrd
gqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakav
lcpgveitfkdeinnteqrwcyq

Sequence, based on observed residues (ATOM records):

>d4hz0a_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrg
mpvdihpeegvpavelilcrlhaggkfsnknyqfsgglvgisvvnalskrvevnvrrdgq
vyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavlc
pgveitfkdeinnteqrwcyq

Timeline for d4hz0a_:

• d4hz0a_ is new in SCOPe 2.03-stable
  
• d4hz0a_ appears in SCOPe 2.04
  
• d4hz0a_ appears in the current release, SCOPe 2.08