Lineage for d4hypd_ (4hyp D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1924946Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 1925002Protein automated matches [191126] (2 species)
    not a true protein
  7. 1925003Species Escherichia coli K-12 [TaxId:83333] [226425] (3 PDB entries)
  8. 1925011Domain d4hypd_: 4hyp D: [222801]
    automated match to d1kzna_
    complexed with 1a1, mg

Details for d4hypd_

PDB Entry: 4hyp (more details), 2.6 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (D:) DNA gyrase subunit b

SCOPe Domain Sequences for d4hypd_:

Sequence, based on SEQRES records: (download)

>d4hypd_ d.122.1.2 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
sflnsgvsirlrdkrdgkedhfhy

Sequence, based on observed residues (ATOM records): (download)

>d4hypd_ d.122.1.2 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgivsaaevimtvlhaggkfkvsgglhgvgvsvvnalsqklelviqregkihrqi
yehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsir
lrdkrdgkedhfhy

SCOPe Domain Coordinates for d4hypd_:

Click to download the PDB-style file with coordinates for d4hypd_.
(The format of our PDB-style files is described here.)

Timeline for d4hypd_: