Lineage for d2jcwa_ (2jcw A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658038Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 658039Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 658052Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 658059Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)
  8. 658070Domain d2jcwa_: 2jcw A: [22280]
    complexed with cu1, zn; mutant

Details for d2jcwa_

PDB Entry: 2jcw (more details), 1.7 Å

PDB Description: reduced bridge-broken yeast cu/zn superoxide dismutase room temperature (298k) structure
PDB Compounds: (A:) cu/zn superoxide dismutase

SCOP Domain Sequences for d2jcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jcwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOP Domain Coordinates for d2jcwa_:

Click to download the PDB-style file with coordinates for d2jcwa_.
(The format of our PDB-style files is described here.)

Timeline for d2jcwa_: