Lineage for d4hy5b_ (4hy5 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038201Domain d4hy5b_: 4hy5 B: [222793]
    Other proteins in same PDB: d4hy5a2
    automated match to d3mupc_
    complexed with 1aq, zn

Details for d4hy5b_

PDB Entry: 4hy5 (more details), 1.75 Å

PDB Description: crystal structure of ciap1 bir3 bound to t3256336
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4hy5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hy5b_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgry

SCOPe Domain Coordinates for d4hy5b_:

Click to download the PDB-style file with coordinates for d4hy5b_.
(The format of our PDB-style files is described here.)

Timeline for d4hy5b_: