Lineage for d4hy1a2 (4hy1 A:216-377)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1402062Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1402063Protein automated matches [190826] (13 species)
    not a true protein
  7. 1402082Species Francisella tularensis [TaxId:376619] [226592] (4 PDB entries)
  8. 1402084Domain d4hy1a2: 4hy1 A:216-377 [222788]
    Other proteins in same PDB: d4hy1a1, d4hy1b1
    automated match to d1s16a1
    complexed with 19x

Details for d4hy1a2

PDB Entry: 4hy1 (more details), 1.9 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hy1a2:

Sequence, based on SEQRES records: (download)

>d4hy1a2 d.14.1.0 (A:216-377) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitnpqfagqtkek
lsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqk

Sequence, based on observed residues (ATOM records): (download)

>d4hy1a2 d.14.1.0 (A:216-377) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknsikitandsfaqlnyvisvkitnpqfagqtkeklsnkd
vtnfvatavkdlltiwlnqnpdearqiveniskvaqk

SCOPe Domain Coordinates for d4hy1a2:

Click to download the PDB-style file with coordinates for d4hy1a2.
(The format of our PDB-style files is described here.)

Timeline for d4hy1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hy1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hy1b1