Lineage for d4hy1a1 (4hy1 A:7-215)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1430131Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1430132Protein automated matches [226867] (10 species)
    not a true protein
  7. 1430158Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)
  8. 1430161Domain d4hy1a1: 4hy1 A:7-215 [222787]
    Other proteins in same PDB: d4hy1a2
    automated match to d1s16a2
    complexed with 19x

Details for d4hy1a1

PDB Entry: 4hy1 (more details), 1.9 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hy1a1:

Sequence, based on SEQRES records: (download)

>d4hy1a1 d.122.1.0 (A:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrle
aeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknl
leakailckaltikysneikkekltwhfe

Sequence, based on observed residues (ATOM records): (download)

>d4hy1a1 d.122.1.0 (A:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsngglhgvgvsvvnalstrleaeikrd
gnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakai
lckaltikysneikkekltwhfe

SCOPe Domain Coordinates for d4hy1a1:

Click to download the PDB-style file with coordinates for d4hy1a1.
(The format of our PDB-style files is described here.)

Timeline for d4hy1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hy1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4hy1b1