![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (13 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:376619] [226592] (4 PDB entries) |
![]() | Domain d4hxza2: 4hxz A:216-383 [222785] Other proteins in same PDB: d4hxza1, d4hxzb1 automated match to d1s16a1 complexed with 19y |
PDB Entry: 4hxz (more details), 2.7 Å
SCOPe Domain Sequences for d4hxza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hxza2 d.14.1.0 (A:216-383) automated matches {Francisella tularensis [TaxId: 376619]} tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd gthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitnpqfagqtkek lsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqkrinadl
Timeline for d4hxza2: