![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
![]() | Protein automated matches [226867] (22 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries) |
![]() | Domain d4hxwa1: 4hxw A:25-231 [222783] Other proteins in same PDB: d4hxwa2 automated match to d1kzna_ complexed with 1a0, tbu |
PDB Entry: 4hxw (more details), 1.69 Å
SCOPe Domain Sequences for d4hxwa1:
Sequence, based on SEQRES records: (download)
>d4hxwa1 d.122.1.0 (A:25-231) automated matches {Enterococcus faecalis [TaxId: 226185]} gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela flnrglhisiedrregqedkkeyhyeg
>d4hxwa1 d.122.1.0 (A:25-231) automated matches {Enterococcus faecalis [TaxId: 226185]} gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg rgipvgiqaktgrpavetvftvlvgssvvnalstsldvrvykdgkvyyqeyrrgavvddl kvieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregqed kkeyhyeg
Timeline for d4hxwa1: