Lineage for d1srdd_ (1srd D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298458Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1298459Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1298472Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1298914Species Spinach (Spinacia oleracea) [TaxId:3562] [49335] (1 PDB entry)
  8. 1298918Domain d1srdd_: 1srd D: [22278]
    complexed with cu, zn

Details for d1srdd_

PDB Entry: 1srd (more details), 2 Å

PDB Description: Three-dimensional structure of CU,ZN-superoxide dismutase from spinach at 2.0 Angstroms resolution
PDB Compounds: (D:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d1srdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srdd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]}
atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
eleddlgkgghelspttgnaggrlacgvvgltpv

SCOPe Domain Coordinates for d1srdd_:

Click to download the PDB-style file with coordinates for d1srdd_.
(The format of our PDB-style files is described here.)

Timeline for d1srdd_: