SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4hxbl2 (4hxb L:108-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (466 PDB entries)
  8. 2025689Domain d4hxbl2: 4hxb L:108-214 [222772]
    Other proteins in same PDB: d4hxbl1
    automated match to d1blna2
    complexed with ca

Details for d4hxbl2

PDB Entry: 4hxb (more details), 2.45 Å

PDB Description: Crystal structure of 6B9 FAB
PDB Compounds: (L:) 6b9 fab light chain

SCOPe Domain Sequences for d4hxbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hxbl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4hxbl2:

Click to download the PDB-style file with coordinates for d4hxbl2.
(The format of our PDB-style files is described here.)

Timeline for d4hxbl2: