Lineage for d1srdc_ (1srd C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55097Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 55196Species Spinach (Spinacia oleracea) [TaxId:3562] [49335] (1 PDB entry)
  8. 55199Domain d1srdc_: 1srd C: [22277]

Details for d1srdc_

PDB Entry: 1srd (more details), 2 Å

PDB Description: Three-dimensional structure of CU,ZN-superoxide dismutase from spinach at 2.0 Angstroms resolution

SCOP Domain Sequences for d1srdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srdc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea)}
atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
eleddlgkgghelspttgnaggrlacgvvgltpv

SCOP Domain Coordinates for d1srdc_:

Click to download the PDB-style file with coordinates for d1srdc_.
(The format of our PDB-style files is described here.)

Timeline for d1srdc_: