SCOPe 2.03: Domain d4hwia2: 4hwi A:189-381

Lineage for d4hwia2 (4hwi A:189-381)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (12 PDB entries)

8. Domain d4hwia2: 4hwi A:189-381 [222768]
   automated match to d1ngfa2

Details for d4hwia2

PDB Entry: 4hwi, 2.27 Å

PDB Description: Crystal structure of ATBAG1 in complex with HSP70

PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d4hwia2:

Sequence; same for both SEQRES and ATOM records:

>d4hwia2 c.55.1.1 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d4hwia2:

• d4hwia2 is new in SCOPe 2.03-stable
  
• d4hwia2 appears in SCOPe 2.04
  
• d4hwia2 appears in the current release, SCOPe 2.08