SCOPe 2.07: Domain d4hwel2: 4hwe L:105-210

Lineage for d4hwel2 (4hwe L:105-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4hwel2: 4hwe L:105-210 [222766]
   Other proteins in same PDB: d4hwel1
   automated match to d1rhha2
   complexed with gol, so4

Details for d4hwel2

PDB Entry: 4hwe, 2.43 Å

PDB Description: Crystal structure of ectodomain 3 of the IL-13 receptor alpha1 in complex with a human neutralizing monoclonal antibody fragment

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4hwel2:

Sequence; same for both SEQRES and ATOM records:

>d4hwel2 b.1.1.2 (L:105-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4hwel2:

• d4hwel2 first appeared in SCOPe 2.03
  
• d4hwel2 appears in SCOPe 2.06
  
• d4hwel2 appears in the current release, SCOPe 2.08