Lineage for d4hwbl2 (4hwb L:105-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367036Domain d4hwbl2: 4hwb L:105-212 [222764]
    automated match to d1dqdl2
    complexed with nhe, so4

Details for d4hwbl2

PDB Entry: 4hwb (more details), 2.61 Å

PDB Description: Crystal structure of ectodomain 3 of the IL-13 receptor alpha 1 in complex with a human neutralizing monoclonal antibody fragment
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4hwbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwbl2 b.1.1.0 (L:105-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgeca

SCOPe Domain Coordinates for d4hwbl2:

Click to download the PDB-style file with coordinates for d4hwbl2.
(The format of our PDB-style files is described here.)

Timeline for d4hwbl2: