SCOPe 2.08: Domain d4hwbl2: 4hwb L:105-212

Lineage for d4hwbl2 (4hwb L:105-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4hwbl2: 4hwb L:105-212 [222764]
   automated match to d1dqdl2
   complexed with nhe, so4

Details for d4hwbl2

PDB Entry: 4hwb, 2.61 Å

PDB Description: Crystal structure of ectodomain 3 of the IL-13 receptor alpha 1 in complex with a human neutralizing monoclonal antibody fragment

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4hwbl2:

Sequence; same for both SEQRES and ATOM records:

>d4hwbl2 b.1.1.0 (L:105-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgeca

Timeline for d4hwbl2:

• d4hwbl2 first appeared in SCOPe 2.03
  
• d4hwbl2 appears in SCOPe 2.07