Lineage for d1srdb_ (1srd B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769113Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1769114Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1769127Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1769583Species Spinach (Spinacia oleracea) [TaxId:3562] [49335] (1 PDB entry)
  8. 1769585Domain d1srdb_: 1srd B: [22276]
    complexed with cu, zn

Details for d1srdb_

PDB Entry: 1srd (more details), 2 Å

PDB Description: Three-dimensional structure of CU,ZN-superoxide dismutase from spinach at 2.0 Angstroms resolution
PDB Compounds: (B:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d1srdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srdb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]}
atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
eleddlgkgghelspttgnaggrlacgvvgltpv

SCOPe Domain Coordinates for d1srdb_:

Click to download the PDB-style file with coordinates for d1srdb_.
(The format of our PDB-style files is described here.)

Timeline for d1srdb_: