SCOP 1.73: Domain d1srdb_: 1srd B:

Lineage for d1srdb_ (1srd B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [49335] (1 PDB entry)

8. Domain d1srdb_: 1srd B: [22276]

Details for d1srdb_

PDB Entry: 1srd, 2 Å

PDB Description: Three-dimensional structure of CU,ZN-superoxide dismutase from spinach at 2.0 Angstroms resolution

PDB Compounds: (B:) Copper,Zinc Superoxide Dismutase

SCOP Domain Sequences for d1srdb_:

Sequence; same for both SEQRES and ATOM records:

>d1srdb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]}
atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
eleddlgkgghelspttgnaggrlacgvvgltpv

Timeline for d1srdb_:

• d1srdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1srdb_ appears in SCOP 1.71
  
• d1srdb_ appears in SCOP 1.75
  
• d1srdb_ appears in the current release, SCOPe 2.08