Lineage for d4hv7x_ (4hv7 X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606016Protein Ricin A-chain [56389] (1 species)
  7. 2606017Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (55 PDB entries)
    Uniprot P06750 28-286
  8. 2606042Domain d4hv7x_: 4hv7 X: [222751]
    automated match to d1il4a_
    complexed with 19j, mla, so4

Details for d4hv7x_

PDB Entry: 4hv7 (more details), 1.87 Å

PDB Description: structure of ricin a chain bound with n-(n-(pterin-7-yl) carbonylglycyl)glycine
PDB Compounds: (X:) ricin

SCOPe Domain Sequences for d4hv7x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hv7x_ d.165.1.1 (X:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d4hv7x_:

Click to download the PDB-style file with coordinates for d4hv7x_.
(The format of our PDB-style files is described here.)

Timeline for d4hv7x_: