Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [49335] (1 PDB entry) |
Domain d1srda_: 1srd A: [22275] |
PDB Entry: 1srd (more details), 2 Å
SCOP Domain Sequences for d1srda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea)} atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh eleddlgkgghelspttgnaggrlacgvvgltpv
Timeline for d1srda_: