Lineage for d4hura_ (4hur A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329958Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329959Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1329988Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 1330055Protein automated matches [190704] (4 species)
    not a true protein
  7. 1330067Species Staphylococcus aureus [TaxId:1280] [193357] (4 PDB entries)
  8. 1330068Domain d4hura_: 4hur A: [222748]
    automated match to d4husb_
    complexed with aco, cl, edo, na, so4

Details for d4hura_

PDB Entry: 4hur (more details), 2.15 Å

PDB Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus in complex with acetyl coenzyme A
PDB Compounds: (A:) Virginiamycin A acetyltransferase

SCOPe Domain Sequences for d4hura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hura_ b.81.1.3 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
wnldmkiinenlpfiingdiemlkrkrklld

SCOPe Domain Coordinates for d4hura_:

Click to download the PDB-style file with coordinates for d4hura_.
(The format of our PDB-style files is described here.)

Timeline for d4hura_: