| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) ![]() automatically mapped to Pfam PF03900 |
| Family d.50.2.0: automated matches [227289] (1 protein) not a true family |
| Protein automated matches [227108] (3 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226599] (1 PDB entry) |
| Domain d4htga2: 4htg A:232-311 [222741] Other proteins in same PDB: d4htga1 automated match to d1gtka2 complexed with 18w, act |
PDB Entry: 4htg (more details), 1.45 Å
SCOPe Domain Sequences for d4htga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4htga2 d.50.2.0 (A:232-311) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nheetrlaiscerafletldgscrtpiagyaskdeegncifrglvaspdgtkvletsrkg
pyvyedmvkmgkdagqells
Timeline for d4htga2: