Lineage for d4htga2 (4htg A:232-311)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190724Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) (S)
    automatically mapped to Pfam PF03900
  5. 2190733Family d.50.2.0: automated matches [227289] (1 protein)
    not a true family
  6. 2190734Protein automated matches [227108] (3 species)
    not a true protein
  7. 2190741Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226599] (1 PDB entry)
  8. 2190742Domain d4htga2: 4htg A:232-311 [222741]
    Other proteins in same PDB: d4htga1
    automated match to d1gtka2
    complexed with 18w, act

Details for d4htga2

PDB Entry: 4htg (more details), 1.45 Å

PDB Description: Porphobilinogen Deaminase from Arabidopsis Thaliana
PDB Compounds: (A:) Porphobilinogen deaminase, chloroplastic

SCOPe Domain Sequences for d4htga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4htga2 d.50.2.0 (A:232-311) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nheetrlaiscerafletldgscrtpiagyaskdeegncifrglvaspdgtkvletsrkg
pyvyedmvkmgkdagqells

SCOPe Domain Coordinates for d4htga2:

Click to download the PDB-style file with coordinates for d4htga2.
(The format of our PDB-style files is described here.)

Timeline for d4htga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4htga1