SCOPe 2.08: Domain d4htga2: 4htg A:232-311

Lineage for d4htga2 (4htg A:232-311)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families)
   automatically mapped to Pfam PF03900

5. Family d.50.2.0: automated matches [227289] (1 protein)
   not a true family

6. Protein automated matches [227108] (3 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226599] (1 PDB entry)

8. Domain d4htga2: 4htg A:232-311 [222741]
   Other proteins in same PDB: d4htga1
   automated match to d1gtka2
   complexed with 18w, act

Details for d4htga2

PDB Entry: 4htg, 1.45 Å

PDB Description: Porphobilinogen Deaminase from Arabidopsis Thaliana

PDB Compounds: (A:) Porphobilinogen deaminase, chloroplastic

SCOPe Domain Sequences for d4htga2:

Sequence; same for both SEQRES and ATOM records:

>d4htga2 d.50.2.0 (A:232-311) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nheetrlaiscerafletldgscrtpiagyaskdeegncifrglvaspdgtkvletsrkg
pyvyedmvkmgkdagqells

Timeline for d4htga2:

• d4htga2 first appeared in SCOPe 2.03
  
• d4htga2 appears in SCOPe 2.07