| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (57 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226598] (1 PDB entry) |
| Domain d4htga1: 4htg A:10-231 [222740] Other proteins in same PDB: d4htga2 automated match to d1pdaa1 complexed with 18w, act |
PDB Entry: 4htg (more details), 1.45 Å
SCOPe Domain Sequences for d4htga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4htga1 c.94.1.0 (A:10-231) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
taiirigtrgsplalaqayetreklkkkhpelvedgaihieiikttgdkilsqpladigg
kglftkeidealinghidiavhsmkdvptylpektilpcnlpredvrdaficltaatlae
lpagsvvgtaslrrksqilhkypalhveenfrgnvqtrlsklqggkvqatllalaglkrl
smtenvasilsldemlpavaqgaigiacrtdddkmatylasl
Timeline for d4htga1: