Lineage for d4ht1l2 (4ht1 L:112-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753415Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (5 PDB entries)
  8. 2753416Domain d4ht1l2: 4ht1 L:112-217 [222739]
    Other proteins in same PDB: d4ht1h_, d4ht1l1
    automated match to d1rhha2

Details for d4ht1l2

PDB Entry: 4ht1 (more details), 2.5 Å

PDB Description: human tweak in complex with the fab fragment of a neutralizing antibody
PDB Compounds: (L:) chimeric antibody Fab

SCOPe Domain Sequences for d4ht1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ht1l2 b.1.1.2 (L:112-217) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4ht1l2:

Click to download the PDB-style file with coordinates for d4ht1l2.
(The format of our PDB-style files is described here.)

Timeline for d4ht1l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ht1l1
View in 3D
Domains from other chains:
(mouse over for more information)
d4ht1h_