SCOPe 2.07: Domain d4hswb_: 4hsw B:

Lineage for d4hswb_ (4hsw B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d4hswb_: 4hsw B: [222737]
   automated match to d4hsxb_
   complexed with gol, hem, so4; mutant

Details for d4hswb_

PDB Entry: 4hsw, 1.22 Å

PDB Description: Structure of the L100F mutant of dehaloperoxidase-hemoglobin A from Amphitrite ornata

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4hswb_:

Sequence; same for both SEQRES and ATOM records:

>d4hswb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4hswb_:

• d4hswb_ first appeared in SCOPe 2.03
  
• d4hswb_ appears in SCOPe 2.06
  
• d4hswb_ appears in the current release, SCOPe 2.08