SCOPe 2.08: Domain d4hs5b_: 4hs5 B:

Lineage for d4hs5b_ (4hs5 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.0: automated matches [227291] (1 protein)
   not a true family

6. Protein automated matches [227112] (1 species)
   not a true protein

7. Species Psychromonas ingrahamii [TaxId:357804] [226618] (3 PDB entries)

8. Domain d4hs5b_: 4hs5 B: [222734]
   automated match to d1ew4a_

Details for d4hs5b_

PDB Entry: 4hs5, 1.45 Å

PDB Description: Frataxin from Psychromonas ingrahamii as a model to study stability modulation within CyaY protein family

PDB Compounds: (B:) Protein cyaY

SCOPe Domain Sequences for d4hs5b_:

Sequence; same for both SEQRES and ATOM records:

>d4hs5b_ d.82.2.0 (B:) automated matches {Psychromonas ingrahamii [TaxId: 357804]}
mndsefiqladqlyqkieekieesgadvdydqngslltlefenhtkliinrqqplhqvwl
atlenghhydynngkwiddrsgdefltflsaaifkqsketvdfte

Timeline for d4hs5b_:

• d4hs5b_ first appeared in SCOPe 2.03
  
• d4hs5b_ appears in SCOPe 2.07