Lineage for d4hs1a_ (4hs1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852707Protein automated matches [190442] (13 species)
    not a true protein
  7. 1852751Species Mycobacterium tuberculosis [TaxId:1773] [226696] (2 PDB entries)
  8. 1852752Domain d4hs1a_: 4hs1 A: [222732]
    automated match to d1r7ha_
    complexed with cl, gol, no3, peg

Details for d4hs1a_

PDB Entry: 4hs1 (more details), 0.87 Å

PDB Description: High-resolution crystal structure of Glutaredoxin like protein NrdH from Mycobacterium tuberculosis.
PDB Compounds: (A:) Glutaredoxin NrdH, putative

SCOPe Domain Sequences for d4hs1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hs1a_ c.47.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw
sgfrpdrikalagaaltahhhhhh

SCOPe Domain Coordinates for d4hs1a_:

Click to download the PDB-style file with coordinates for d4hs1a_.
(The format of our PDB-style files is described here.)

Timeline for d4hs1a_: