Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (13 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [226696] (2 PDB entries) |
Domain d4hs1a_: 4hs1 A: [222732] automated match to d1r7ha_ complexed with cl, gol, no3, peg |
PDB Entry: 4hs1 (more details), 0.87 Å
SCOPe Domain Sequences for d4hs1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hs1a_ c.47.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw sgfrpdrikalagaaltahhhhhh
Timeline for d4hs1a_: